DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:216 Identity:46/216 - (21%)
Similarity:83/216 - (38%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SNWWDSSCPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASL 102
            |:..::..|.:.::..||:     :|:.||:.|..:       ......:..|.||..|:..|..
  Rat    37 SSGLNAKLPLEEDVDFINE-----YVNLHNELRGTV-------FPPGVNLRFMTWDVALSRTARA 89

  Fly   103 NVRQC--------NMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNA 159
            ..::|        :.||:| |  ..|...|:|: |..     |:..:...|:::.|.:|..:.|.
  Rat    90 WGKKCVFERNTHLDKVHES-H--PVFTDIGENM-WVG-----PEKDFTATNAIRSWHEERKSYNY 145

  Fly   160 GIIAGGYPSGYNGPAI-----GHFTVMMSERNTRLGCAAARYNRDG--WNQVLVACNYATTNMIG 217
                      .|...|     .|:..::.:.:.::|||.....:.|  ....|..||||....:.
  Rat   146 ----------VNDTCIEDEDCSHYIQLVWDHSYKVGCAVTPCAKVGAITYAALFICNYAPGGTLT 200

  Fly   218 RQIYSSCDWGAQGCGSGTNGE 238
            |:.|.:    .|.|...||.|
  Rat   201 RRPYQA----GQFCSRCTNEE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 33/163 (20%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 37/176 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.