DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and R3hdml

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:203 Identity:61/203 - (30%)
Similarity:83/203 - (40%) Gaps:56/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAY 132
            |..|:|..   |.|..|..|..|.||::||..|.....||...|.....|   ||.||||:  .:
  Rat    68 DYHNHIRA---SVHPPASNMEYMVWDEQLARAAEAWATQCIWAHGPSQLT---KYVGQNLS--VH 124

  Fly   133 SG---DLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSG----------YNGPAIGHFTVMMSE 184
            ||   .:.|:       |:.|.:|..:.:       :|:.          .:||...|:|.|:..
  Rat   125 SGRYRSVVDL-------VKSWSEEKRHYS-------FPAPKDCTPHCPWLCSGPVCSHYTQMVWA 175

  Fly   185 RNTRLGCA---AARYNRDG--WNQ-VLVACNYATT-NMIGRQIY------SSCDWGAQG-CGSGT 235
            .::|||||   .:..|..|  |.| |.:.||||.. |.||...|      |:|....|| |.|  
  Rat   176 SSSRLGCAIHTCSSINVWGSTWQQAVYLVCNYAIKGNWIGEAPYKTGKPCSACPPSYQGNCNS-- 238

  Fly   236 NGEFGNLC 243
                 |:|
  Rat   239 -----NMC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 47/161 (29%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.