DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Crisp2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:193 Identity:40/193 - (20%)
Similarity:69/193 - (35%) Gaps:39/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNL 127
            :..||:.|..::       .....:..|||:.:.|..|......|.:.|.|..:.......|:||
  Rat    42 IAKHNELRRQVS-------PPGSNILKMEWNVQAAANAQKWANNCILEHSSTEDRKINIKCGENL 99

  Fly   128 -------AWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSER 185
                   :|:..              :|.|::|..|...|:  |..|:.    |:||:|.::...
  Rat   100 YMSTDPTSWRTV--------------IQSWYEENENFVFGV--GAKPNS----AVGHYTQLVWYS 144

  Fly   186 NTRLGCAAARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQG--CGSGTNGEFGNLCSTS 246
            :.::||..|........:....|:|..   :|..:........||  |.|..|.....||:.|
  Rat   145 SFKVGCGVAYCPNQDTLKYFYVCHYCP---MGNNVMKKSTPYHQGTPCASCPNNCDNGLCTNS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 30/154 (19%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 31/159 (19%)
Crisp 189..243 CDD:400739 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344746
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.