DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Clec18a

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:269 Identity:49/269 - (18%)
Similarity:86/269 - (31%) Gaps:85/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCP---GDAELIDINDDYKWVFVHSHN 67
            |.:|::.|:|...|                    |.:...|   .|..|..::....::.:.:||
Mouse    91 LGLLLLLLSLLGIT--------------------WTEVQPPQPKQDPTLQALSRKESFLILTAHN 135

  Fly    68 DKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQC------NMVHDSCHNTDAFKYSGQN 126
            ..|:.:       |..|..|..|:|.:.||.||......|      |:.....||:        :
Mouse   136 RLRSRV-------HPPAANMQRMDWSESLAQLAEARAALCVTSVTPNLASTPGHNS--------H 185

  Fly   127 LAWQAYSGDLPDMGYILDNSVQMWFDE-----------VHNSNAGIIAGGYPSGYNGPAIGHFTV 180
            :.|......:....::  ..|.:||.|           .||:..                .|:|.
Mouse   186 VGWNVQLMPMGSASFV--EVVNLWFAEGLQYRHGDAECAHNATC----------------AHYTQ 232

  Fly   181 MMSERNTRLGCAAARYNRDGWNQVLVACNYA---TTNMIGRQI--YSSCDWGAQGCGSGTNGEF- 239
            ::...:::|||.......|........|.|:   ..::.|:.:  |....| ...|.:..:|.| 
Mouse   233 LVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKGTW-CSLCTARVSGCFK 296

  Fly   240 -----GNLC 243
                 |.||
Mouse   297 AWDHAGGLC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 30/165 (18%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 30/166 (18%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.