DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG10651

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:108/237 - (45%) Gaps:11/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATD-YCSSDICNGGSHIACGHSNWWDSSCPGD-AELIDINDDYKWVFVHSHNDKRNYIAGGYDSN 80
            |:| :|.:|:|. |.|:.|..:..::|:||.. |.::.::.|...:.|..||:.||..|||.|.|
  Fly    19 ASDKWCKADLCR-GQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQN 82

  Fly    81 HNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDN 145
            ..|| ||.|:|||.|||.:|...||:|..:.|.|..|..:.::..:.:.:.|. .:......|..
  Fly    83 PKAA-RMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYF-CMTTKKEALRK 145

  Fly   146 SVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNY 210
            .:..|||.........:...:.......:..:|.| :.:|..|:|||...|.|......|:.|.|
  Fly   146 QLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQV-LRDRANRVGCAIVEYVRPALVHQLLKCVY 209

  Fly   211 ----ATTNMIGRQIYSSCD-WGAQGCGSGTNGEFGNLCSTSE 247
                :........:|...| ..|..|..|:|.::.|||...|
  Fly   210 NCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/152 (30%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 44/151 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.