Sequence 1: | NP_524689.2 | Gene: | Ag5r2 / 44079 | FlyBaseID: | FBgn0020508 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021327299.1 | Gene: | glipr2 / 325699 | ZFINID: | ZDB-GENE-030131-4424 | Length: | 543 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 66/201 - (32%) | Gaps: | 61/201 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FVHSHNDKRNYIAGGYDSNHNA--------ACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTD 118
Fly 119 AFKYSGQNL--AWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVM 181
Fly 182 MSERNTRLGCAAARYNRDGWNQVLVACNYATTNMIGRQIY---------SSCD---WGAQGCGSG 234
Fly 235 TNGEFG 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ag5r2 | NP_524689.2 | SCP_euk | 62..211 | CDD:240180 | 36/158 (23%) |
glipr2 | XP_021327299.1 | SCP_GAPR-1_like | 5..135 | CDD:240182 | 37/163 (23%) |
SCP_GAPR-1_like | 196..326 | CDD:240182 | |||
SCP_GAPR-1_like | 397..528 | CDD:240182 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |