DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG9400

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:129/254 - (50%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVSLALAQATDYCSSDICN--GGSHI------ACGHSNWWDSSCPGDAELIDINDDYKWVFVHSH 66
            |.:...|.:..||::.:|.  .|:|:      |||::..:..:|..:.:|:::::..:.:.:..|
  Fly    39 ITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMH 103

  Fly    67 NDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQA 131
            |..|:.||.|....:.:|..|..:.||.||..:|:|:.::|...||.|.||..||:||||:.:..
  Fly   104 NLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFW 168

  Fly   132 YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARY 196
            ...:.......:.:.|..||.|..::|...|...:|.. .|..|||||:::|:|..|:|||..|:
  Fly   169 IGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHP-QGKKIGHFTLLVSDRVNRVGCAGVRF 232

  Fly   197 NRDGWN--QVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYDVNS 253
            .....|  |.::.|||...|:....||.|...|::......:.:|.:||   :|.|.|:
  Fly   233 LEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLC---DWRDANN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 50/150 (33%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 50/153 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440615
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.