DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG31296

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:255 Identity:66/255 - (25%)
Similarity:117/255 - (45%) Gaps:17/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAIL-IVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHNDK 69
            :|:| .:....::..|:|....| |.:::||.:.:.:...||.:|..:.:: .|:.:.:.:.|:.
  Fly     9 VALLNFIPFGCSKLVDFCQLPYC-GTNNLACNNPSKFSVMCPPNARTLSMS-TYRNLLLIAFNEF 71

  Fly    70 RNYIAGGYDSN-HNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYS 133
            |||.|.|.... ..||.||:.:.:..||..||.|.|..|: .|..|.|:..|.|.|.|:....|.
  Fly    72 RNYTASGKQKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIGSTHYL 135

  Fly   134 GDLPDMGY----ILDNSVQMW--FDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCA 192
            |:|.|  |    ::...:|.|  :.:..|...|:.   .|:......|....::|::|||.:||:
  Fly   136 GNLND--YEDLELMLRIIQHWTRYADYVNIKMGVY---MPTTLGKSGIAKALLLMADRNTHVGCS 195

  Fly   193 AARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYDVN 252
            |.|:.....:..:..|.::|...:.|.||.........| ...:..:..||:..|.|:.|
  Fly   196 AMRFTVHSVHNFVFLCAFSTDLFVERPIYRMSMRPGAAC-KRLDPTYSALCAVGENYENN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 44/155 (28%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 44/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.