DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG31286

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:138 Identity:27/138 - (19%)
Similarity:44/138 - (31%) Gaps:40/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 MATMEWDDELAY---LASLNVRQCNMVHDSCHNT------DAFKYSGQNLAWQAYSGDLPDMGYI 142
            :|..|:|...|.   .|.:.:|:.|...|. |..      :......|:.||:            
  Fly    13 VAISEFDRNFAINHDNAGIVLREINKRRDR-HGVPKLTLDNVLSKGCQSYAWK------------ 64

  Fly   143 LDNSVQMWFDEVHNSN-----------AGIIAGGYPSGYNG-------PAIGHFTVMMSERNTRL 189
            |..|..:.:.:..|.:           .|.::....:.|||       |....||.|:...:..|
  Fly    65 LSKSATLNYSDPTNKDYTESICRFEVKRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSL 129

  Fly   190 GCAAARYN 197
            |...|..|
  Fly   130 GYGDANIN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 27/138 (20%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455147
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.