DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Crispld1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:289 Identity:71/289 - (24%)
Similarity:103/289 - (35%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LALLAILIV-----SLALAQAT-------DYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDIN 55
            |.:.|:|.|     ::.:..||       .|...|            ..||.:...|...:.| |
  Rat     9 LRMTALLFVARAVPAMVVPNATLLEKLLEKYMDED------------DEWWTAKQRGKRAITD-N 60

  Fly    56 DDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAF 120
            |...  .:..||..|:.:       :.||..|..|.||.||...|......|...|..   |...
  Rat    61 DMQS--ILDLHNKLRSQV-------YPAASNMEYMTWDVELERSAESWAETCLWEHGP---TSLL 113

  Fly   121 KYSGQNLA--WQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGY----------NGP 173
            ...||||.  |..|.   |...:     ||.|:|||.:.:       ||..:          :||
  Rat   114 PSIGQNLGAHWGRYR---PPTFH-----VQAWYDEVRDFS-------YPYEHECDPYCPFRCSGP 163

  Fly   174 AIGHFTVMMSERNTRLGCAA-ARYNRDGWNQ-----VLVACNYATT-NMIGRQIY------SSC- 224
            ...|:|.::...::|:|||. ..:|.:.|.|     |.:.|||:.. |..|...|      |:| 
  Rat   164 VCTHYTQVVWATSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGKPCSACP 228

  Fly   225 -DWGAQGCGSGTNGEFGNLC---STSEWY 249
             .:|. ||..       |||   .:.::|
  Rat   229 PSFGG-GCRE-------NLCYKEGSDQYY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 44/166 (27%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 44/170 (26%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.