DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Clec18a

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:224 Identity:48/224 - (21%)
Similarity:74/224 - (33%) Gaps:86/224 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSG 124
            ::.:.:||..|:.:       |.:|..|..|:|.:.||.||......|        .|.|    .
  Rat    76 FLILTTHNRLRSQV-------HPSAANMQRMDWSESLAQLAQARAALC--------GTSA----T 121

  Fly   125 QNLAWQAYSGDLPDMGYILD----------NSVQMWFDE-----------VHNSNAGIIAGGYPS 168
            .|||  |...:.||:|:.:.          ..|.:||.|           .||:..         
  Rat   122 PNLA--ATLRNTPDVGWNVQLLPMGSASFVEVVNVWFAEGLQYRHGSAECAHNATC--------- 175

  Fly   169 GYNGPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLV--------ACNYA---TTNMIGRQI-- 220
                   .|:|.::...:::|||        ||....|        .|.|:   ...:.|:.|  
  Rat   176 -------AHYTQLVWATSSQLGC--------GWQPCFVDQVATEAFVCAYSPGGNWEINGKMIAP 225

  Fly   221 YSSCDWGAQGCGSGTNGEF------GNLC 243
            |....| ...|.:..:|.|      |.||
  Rat   226 YKKGPW-CSLCTASVSGCFKAWDHAGGLC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 37/177 (21%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 37/178 (21%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.