DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Glipr1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:226 Identity:50/226 - (22%)
Similarity:82/226 - (36%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WWDSSCPGDAELID-----INDDY--KWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELA 97
            |..||..|.:....     .|:|:  :.|.||:|...:.|...|         .|..|.||.:||
  Rat    10 WMASSASGFSYTASTLPKITNEDFIEECVEVHNHFRSKAYPPAG---------NMLYMSWDPKLA 65

  Fly    98 YLASLNVRQC-----NMVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMG----YILDNSVQMWFDE 153
            .:|....:.|     ..:|...|..  |...|:|: |         :|    :.:..::..||:|
  Rat    66 QIAKAWAQSCVFQHNPQLHSRIHPN--FTGLGENI-W---------LGSLSLFSVRAAILAWFEE 118

  Fly   154 VHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNYATTNMIGR 218
            ....:       :.:|......||:|.::...:.::|||.....| |.|.:   |||........
  Rat   119 SQYYD-------FSTGKCKKVCGHYTQIVWADSYKIGCAVQLCPR-GANFI---CNYGPAGNYPT 172

  Fly   219 QIYSSCDWGAQGCGSGTNGE--FGNLCSTSE 247
            ..|..   ||. |.:....:  ..|||:..:
  Rat   173 WPYKQ---GAT-CSACPKDDKCLNNLCTNPQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 35/157 (22%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.