DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CLEC18C

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:265 Identity:53/265 - (20%)
Similarity:86/265 - (32%) Gaps:78/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELID-INDDYKWVFVHSHND 68
            |||:|:..|..|.|                    ..|.......|.:.. :|....::.:..||.
Human    13 LLAVLLALLGTAWA--------------------EVWPPQLQEQAPMAGALNRKESFLLLSLHNR 57

  Fly    69 KRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYS 133
            .|:::       ...|..|..::|.|.||.||......|.:...|.       .||   .|:.. 
Human    58 LRSWV-------QPPAADMRRLDWSDSLAQLAQARAALCGIPTPSL-------ASG---LWRTL- 104

  Fly   134 GDLPDMGYILD----------NSVQMWFDE--VHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERN 186
                .:|:.:.          ..|.:||.|  .::..||..|       ......|:|.::...:
Human   105 ----QVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECA-------RNATCTHYTQLVWATS 158

  Fly   187 TRLGCAAARYNRDGWNQVLVA--CNYA---TTNMIGRQI--YSSCDWGAQGCGSGTNGEF----- 239
            ::|||  .|:........:.|  |.|:   ...:.|:.|  |....| ...|.:..:|.|     
Human   159 SQLGC--GRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAW-CSLCTASVSGCFKAWDH 220

  Fly   240 -GNLC 243
             |.||
Human   221 AGGLC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 32/162 (20%)
CLEC18CNP_775890.2 SCP_euk 50..183 CDD:240180 32/163 (20%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.