DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:307 Identity:61/307 - (19%)
Similarity:97/307 - (31%) Gaps:122/307 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CSSDICNGGSHI------------------ACGHSNW-----W-----DSSCPG----------- 47
            |||::|..|:.:                  ||. :.|     |     .|.||.           
Human    16 CSSELCGRGTLLPVLPHSDTDKLIQPRWARACA-AGWSQGRAWCGGVGKSGCPSRYWSAQSGHPP 79

  Fly    48 ---------------------------DAELIDINDDYKWVF----VHSHNDKRNYIAGGYDSNH 81
                                       .:::..|.|.:   |    :.:||:.|..:       :
Human    80 HPPHPSMALKNKFSCLWILGLCLVATTSSKIPSITDPH---FIDNCIEAHNEWRGKV-------N 134

  Fly    82 NAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTD-----AFKYSGQNLAWQAYSGDLPDMGY 141
            ..|..|..|.||..||.:|.....||...|:.|.:..     ||:|.|:|: |         :|.
Human   135 PPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENI-W---------LGG 189

  Fly   142 ILD----NSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARY-NRDGW 201
            |..    :::..|::|....:       :.|.......||:|.::...:..:|||.|.. |..|.
Human   190 IKSFTPRHAITAWYNETQFYD-------FDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGA 247

  Fly   202 NQVLVACNYATT-NMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSE 247
            :..:..|||... |......|             ..||..:|||..|
Human   248 STAIFVCNYGPAGNFANMPPY-------------VRGESCSLCSKEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 38/162 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.