DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG30486

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:124/264 - (46%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LALLAILIVSLALAQA--TDYCSSDICNGG-SHIACGHSNWWDSSCPGDAELIDINDDYKWVFVH 64
            |.||::||:.|...:|  ||||:.|:|... :||||.:...:|.||..:|.::...     :.:.
  Fly     2 LYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFP-----MHMR 61

  Fly    65 SH-----NDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSG 124
            :|     ||.||.:|.|...:...|.||||:.|.:|||.||...:|:|:.:.|.|.|||.|.|..
  Fly    62 AHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVS 126

  Fly   125 Q---NLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERN 186
            .   :..|.....|...   :||..:|.|.|:|.......|....|: .:|...|:||.::.:..
  Fly   127 YIYGSTKWLQLEKDPIS---VLDFVLQFWMDDVKGCTMAHINAEKPA-KDGQCRGYFTQLVQDLA 187

  Fly   187 TRLGCA--AARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWY 249
            ..:|||  ..:....|..|..|.|:::...:....:|.:.......|.:||:..:..|||..|..
  Fly   188 AHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHV 252

  Fly   250 DVNS 253
            :.|:
  Fly   253 NPNA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 48/158 (30%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440600
Domainoid 1 1.000 51 1.000 Domainoid score I18735
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.