DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and scl-27

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:196 Identity:46/196 - (23%)
Similarity:78/196 - (39%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VHSHNDKRNYIAGGYDSNHN---AACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKY-- 122
            |..||:..|.:|.|...||:   .|.:|..|:|:..||....      |:.| ||..... :|  
 Worm    28 VKVHNELGNDVACGKYQNHSDYPKASQMMMMKWNQSLAEAVG------NVKH-SCQQLKE-RYLK 84

  Fly   123 ---SGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSE 184
               .|:|| ::.|.     ...::|...:.  ||:...:...::.|  :.:.   :..|..::.:
 Worm    85 KFIKGENL-YRVYF-----YNTVVDGLQER--DEILRRSEKAVSTG--ANFE---VERFHKILHD 136

  Fly   185 RNTRLGCAAARYNRD-GWNQVLVACNYATTNMIGRQIY------SSCDWGAQGCGSGTNGEFGNL 242
            :.|.:||:......| |::.....|.|:..:  ...:|      |.|..|. .|....|.||.||
 Worm   137 KVTSIGCSYKNCENDQGYDMRYFICKYSPID--NGDMYHVGEPCSQCPVGT-SCNQNANSEFFNL 198

  Fly   243 C 243
            |
 Worm   199 C 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 34/156 (22%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 34/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.