DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and scl-12

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_504056.1 Gene:scl-12 / 186714 WormBaseID:WBGene00019178 Length:208 Species:Caenorhabditis elegans


Alignment Length:257 Identity:66/257 - (25%)
Similarity:89/257 - (34%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65
            ||.||..|.|...|.||.:....:.|                                    |.:
 Worm     1 MKFALYLIAIFGCATAQFSSTAQTAI------------------------------------VKA 29

  Fly    66 HNDKRNYIA-GGYDSN---HNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQN 126
            |||.|:.|| |.||:.   ...|..|..::||..:|..|......|...|...      :| |:|
 Worm    30 HNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDHSGT------EY-GEN 87

  Fly   127 LAWQAYSGDLP----DMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNT 187
            |.| ::|...|    ..|....||.:..|.:....:..:.|..:.||     |||.|.|......
 Worm    88 LYW-SWSSSAPTSLDKFGVAASNSWEKEFQDYGWESTYMDADLFDSG-----IGHATQMAWAETN 146

  Fly   188 RLGCAAARYNRD----GWNQVLVACNY-ATTNMIGRQIYSSCDWGAQGCGSGTN-GEFGNLC 243
            ::||......:|    ...:|.|.|.| ...||:...||.|.| ....|.||:. .|...||
 Worm   147 KIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMMDSDIYQSGD-TCSFCPSGSKCEEASGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 44/161 (27%)
scl-12NP_504056.1 SCP 21..175 CDD:214553 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.