DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and F57B7.2

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:239 Identity:47/239 - (19%)
Similarity:70/239 - (29%) Gaps:93/239 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NYIAGGYDSNHNAACRMATME----WDDEL--------------------AYLASLNV-RQCNMV 110
            |.::..|..::.|.|.....|    :|.:|                    ..|:.:|. |.|...
 Worm    97 NNVSNSYGDDYEAVCSSIGEESRKNFDAQLDKHMMQTITDVKYMIKHSKYTALSEVNFQRSCLDA 161

  Fly   111 HDSCHNTDAFKYSGQNLAW--------QAYSGDLPDMGYILDNSVQMWFDEVHNSNAGII----- 162
            |:.|..    :|..:||.|        .|::..|.|.|.:|       :.|:......:|     
 Worm   162 HNECRQ----RYGNENLCWSTELAEMAHAWAVKLADRGRVL-------YPELPGIGENLILKEAN 215

  Fly   163 -AGGYPSGYN-------------------GPAIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVA 207
             ....|:|..                   .|....|:.::.:..|.||  ||||.....|.|.|.
 Worm   216 EQSHLPTGQEVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELG--AARYWNTANNCVAVV 278

  Fly   208 CNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNL-----CSTS 246
            |.|....                 .|...|||.:.     ||.|
 Worm   279 CFYRPAG-----------------NSNAPGEFASNVPSRDCSMS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 39/197 (20%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 32/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.