DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and scl-10

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502498.1 Gene:scl-10 / 186049 WormBaseID:WBGene00009891 Length:212 Species:Caenorhabditis elegans


Alignment Length:210 Identity:54/210 - (25%)
Similarity:77/210 - (36%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LIDINDDYKWVFVHSHNDKRNYIA-GGY---DSNHNAACRMATMEWDDELAYLASLNVRQCNMVH 111
            |.:.::..|...:..||..|:.|| |.|   :|...:|..|..:.||..|...|......|...|
 Worm    19 LCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGH 83

  Fly   112 DSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDN-SVQMWFDEVHNSNAGIIAGGYPSGYNG--- 172
            .:....     .|:|:.|............:|.| |..:|..|...           .|:||   
 Worm    84 SASRAN-----IGENMYWWTSPVVTQTDAELLGNRSANLWESEFQR-----------FGWNGNLL 132

  Fly   173 ------PAIGHFTVMMSERNTRLGCAAARYNRDGW-NQVLVACNYATT-NMIGRQIYSSCDWGAQ 229
                  ..|||.|.|......::||..::.:.|.: .|.:|.|.|:.. |.||..||.|.: ...
 Worm   133 TEELFNSGIGHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGE-TCS 196

  Fly   230 GCGSGTNGEFG-NLC 243
            .|..|||.|.. .||
 Worm   197 NCPDGTNCESSTGLC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 38/163 (23%)
scl-10NP_502498.1 SCP 25..179 CDD:214553 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.