DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and scl-26

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:205 Identity:41/205 - (20%)
Similarity:72/205 - (35%) Gaps:56/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YKW--------VFVHSHNDKRNYIAGGYDSNHN--AACRMATMEWDDELAYLASLNVRQCNMVH- 111
            ::|        |||  ||..||..:.|..:.||  .:..|..:.|::.|...|...:..|:.:. 
 Worm    20 HEWNETAIEGLVFV--HNKLRNDASQGLWARHNISKSTDMQKLFWNNSLVAEAKHEMYDCDQLEK 82

  Fly   112 ------DSCHNTDAFKY---SGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYP 167
                  ::.:..|...|   .||. ...|.:.|..|.....|.:.|....:              
 Worm    83 RELTLGENIYQYDVTTYDDVDGQQ-GEAAINKDSHDALSSKDQAAQYRLRQ-------------- 132

  Fly   168 SGYNGPAIGHFTVMMSERNTRLGC---AAARYNRDG--WNQVLVACNYA-TTNMIGRQIYSSCDW 226
                        ::.|:.|: :||   :..|.:.:|  :|...:.|.|: ....|..|:|...:.
 Worm   133 ------------ILYSKSNS-IGCIYESCDRIDDEGTNYNTRFIICKYSPALKNIDDQLYEEGEE 184

  Fly   227 GAQGCGSGTN 236
            ....|.|||:
 Worm   185 ACSNCPSGTS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 31/165 (19%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 32/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.