Sequence 1: | NP_524689.2 | Gene: | Ag5r2 / 44079 | FlyBaseID: | FBgn0020508 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502508.1 | Gene: | scl-6 / 183343 | WormBaseID: | WBGene00008028 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 47/209 - (22%) |
---|---|---|---|
Similarity: | 74/209 - (35%) | Gaps: | 28/209 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 DAELIDINDDYKWVFVHSHNDKRNYIA-GGYDSNHN---AACRMATMEWDDELAYLASLNVRQCN 108
Fly 109 MVHDSCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNG- 172
Fly 173 ----PAIGHFTVMMSERNTRLGCAAARYNRD--GWNQVLVACNYATTNMIGRQIYSSCDWGAQGC 231
Fly 232 GSGTN-GEFGNLCS 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ag5r2 | NP_524689.2 | SCP_euk | 62..211 | CDD:240180 | 37/159 (23%) |
scl-6 | NP_502508.1 | SCP | 23..176 | CDD:214553 | 38/168 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I8510 |
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I3895 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.970 |