DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and C07A4.3

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:197 Identity:52/197 - (26%)
Similarity:72/197 - (36%) Gaps:52/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 INDDYKWVFVHSHNDKRNY---IAGGYDSN-HNAACRMATMEWDDELAYLASLNVRQCNMVHDSC 114
            |.|..||: ||.||..|.:   .|...||| .|.|     .:|.||:|:     .::| :||:  
 Worm    41 IKDLKKWI-VHFHNKYRAHHSSPAVTVDSNLTNLA-----QKWSDEMAF-----HKKC-LVHE-- 91

  Fly   115 HNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYN------GP 173
               ...|| |:||...|.|.                |.......|.:|.|.|..||.      .|
 Worm    92 ---QPSKY-GENLTSFASSK----------------FPSPKTCAAALIHGFYTEGYGFNYTRFNP 136

  Fly   174 A----IGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNY-ATTNMIGRQIYSS---CDWGAQG 230
            .    :||||.::.:.:.::|...:...|.....|.|...| ...||...:.|..   ......|
 Worm   137 GSWSKVGHFTQLLWKNSRKIGVGVSVAKRGTMYHVYVCIKYDPPGNMQTSEAYMDNVRAPKSTSG 201

  Fly   231 CG 232
            ||
 Worm   202 CG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 42/163 (26%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.