DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and lon-1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:203 Identity:53/203 - (26%)
Similarity:79/203 - (38%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYS 123
            ||: .|.||..|..:         .|..|..:.|.||||..|..:...|:           |::|
 Worm    82 KWI-THEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCD-----------FRHS 125

  Fly   124 ------GQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMM 182
                  |:|: |.|     |...|  .:::.:||:||||...|.     ...|. ...||:..::
 Worm   126 RGRINVGENI-WAA-----PYSNY--SDAISIWFNEVHNPRCGC-----NHAYK-HCCGHYVQVV 176

  Fly   183 SERNTRLGCAAARYNRD-------GWNQVLVACNY----ATTNMIGR-QIYS--SCDWGAQGCGS 233
            ..:...:||..:|. ||       |...|.| |:|    .|..:..| |:|:  :..|     .|
 Worm   177 WAKTNLVGCGFSRC-RDVQGVWGRGHRNVFV-CHYNPQGNTVFVTARGQLYAMPAFTW-----AS 234

  Fly   234 GTNGEFGN 241
            |.||:..|
 Worm   235 GDNGKCSN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 41/165 (25%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.