Sequence 1: | NP_524689.2 | Gene: | Ag5r2 / 44079 | FlyBaseID: | FBgn0020508 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498166.1 | Gene: | lon-1 / 175753 | WormBaseID: | WBGene00003055 | Length: | 312 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 53/203 - (26%) |
---|---|---|---|
Similarity: | 79/203 - (38%) | Gaps: | 62/203 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 KWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYS 123
Fly 124 ------GQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMM 182
Fly 183 SERNTRLGCAAARYNRD-------GWNQVLVACNY----ATTNMIGR-QIYS--SCDWGAQGCGS 233
Fly 234 GTNGEFGN 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ag5r2 | NP_524689.2 | SCP_euk | 62..211 | CDD:240180 | 41/165 (25%) |
lon-1 | NP_498166.1 | SCP | 81..211 | CDD:214553 | 43/165 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |