DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and CG43777

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:276 Identity:67/276 - (24%)
Similarity:112/276 - (40%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLALLAILIVSLALAQATDYCSSD----ICNGGSHIAC--------GHSNWWDSSCPGDAELID 53
            |...||..:::.|.|....:||::.    :.....|..|        |:|..:.:|.|.:..:..
  Fly     1 MMWRLLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMRMQK 65

  Fly    54 INDDYKWVFVHSHNDKRNYIAGGY-----DSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDS 113
            |..|..       |:.||..|||.     :.....|.||..:.||.||||:.:.:....::....
  Fly    66 IALDIL-------NNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQ 123

  Fly   114 CHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEV-HNSNAGIIAGGYPSGYNGPAIGH 177
            |.:|..|.:.|:.:|.......| ::..|...:....|.|. |.|:...:...:....:. .:.|
  Fly   124 CRSTLRFPHVGEAIALVTPREKL-NLKEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDF-QVRH 186

  Fly   178 FTVMMSERNTRLGCAAARYNRDGWNQVLVACNYATT-----NMIGRQIY------SSC-DWGAQG 230
            ||.::|:|.:|:||..|  .....|..:..|::.|.     ||.|..:|      ||| |||.. 
  Fly   187 FTNIISDRVSRVGCGVA--VGANCNPSIKFCHFLTCYFDFHNMAGSYVYKAGDPTSSCDDWGVV- 248

  Fly   231 CGSGTNGEFGNLCSTS 246
                ::.::.|||..|
  Fly   249 ----SSDKYANLCKNS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 37/154 (24%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440614
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.