DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and Crisp1

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:182 Identity:39/182 - (21%)
Similarity:66/182 - (36%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SNHNAACRMAT--------MEWDDELAYLASLNVRQ----CNMVHDSCHNTDAFKYSGQNLAWQA 131
            |.||...||.:        |||:    |.|.:|.:|    |...|............|:||...:
Mouse    44 SKHNQLRRMVSPSGSDLLKMEWN----YDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSS 104

  Fly   132 YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGP--AIGHFTVMMSERNTRLGCAAA 194
            |...       ..:::|.|::|..:..       |..|...|  .:||:|.::.....::.|..|
Mouse   105 YLAS-------WSSAIQGWYNEYKDLT-------YDVGPKQPDSVVGHYTQVVWNSTFQVACGVA 155

  Fly   195 RYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTS 246
            ...::......| |:|........::|:....| :.|.|..:.....||:.|
Mouse   156 ECPKNPLRYYYV-CHYCPVGNYQGRLYTPYTAG-EPCASCPDHCEDGLCTNS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 31/145 (21%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 32/146 (22%)
Crisp 190..244 CDD:285731 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.