DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and glipr1a

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:224 Identity:59/224 - (26%)
Similarity:84/224 - (37%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LIDINDDYKWVF----VHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVH 111
            |.||.|.   .|    |..||..|:.::       ..|..|..|.||..||..|....|.|...|
Zfish    23 LFDITDR---AFIDECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKH 77

  Fly   112 DSCHNTDA------FKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGY 170
             :.|..:|      |...|:|: |    ...|...:.:.::|..|.:|:.:.|           |
Zfish    78 -NIHLREAKRVHPTFTTVGENI-W----AGAPYSRFTVKSAVFSWVNELKDYN-----------Y 125

  Fly   171 NG------PAIGHFTVMMSERNTRLGCA-------AARYNRDGWNQVLVACNYATT-NMIGRQIY 221
            |.      ...||:|.::...:.::|||       .|..:......|:..|||||. |..||..|
Zfish   126 NNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPY 190

  Fly   222 ---SSCDWGAQGCGSGTNGEFGNLCSTSE 247
               :||    .|||.....| .|||..::
Zfish   191 KQGASC----SGCGGSDKCE-RNLCRNTD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 39/171 (23%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.