DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and LOC101883528

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:245 Identity:53/245 - (21%)
Similarity:93/245 - (37%) Gaps:77/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHNDKRNYI 73
            :|:|||:.|.|:   .:|.|                      ::|:           ||:.|:.:
Zfish    14 VILSLAVGQLTE---QEILN----------------------IVDL-----------HNELRSQV 42

  Fly    74 AGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYS-GQNLAWQAYSGDLP 137
                   ..:|..|..:.||:.:..:|.....:|  :.|  ||.|....: |:||    :.|..|
Zfish    43 -------QPSAAFMQKVVWDETIRLVAEGYAAKC--IWD--HNPDLEHLTMGENL----FVGTGP 92

  Fly   138 DMGYILDNSVQMWFDE--VHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYNRDG 200
               :....:|..||:|  .:|.|....|       .....||:|.::....|::|||:  |..|.
Zfish    93 ---FNATKAVMDWFNENLDYNYNTNDCA-------EDKMCGHYTQLVWANTTKIGCAS--YFCDT 145

  Fly   201 WNQV------LVACN-YATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLC 243
            ..::      |:.|: |...|:.|::.|.|    .:.|.........|:|
Zfish   146 LEKLHFEKATLLICDYYPQGNIEGQKPYES----GESCSKCPEECENNIC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 36/158 (23%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 39/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.