DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and LOC101732829

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:219 Identity:59/219 - (26%)
Similarity:84/219 - (38%) Gaps:45/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMV 110
            |.:.:..| |...:.:.|..||..|..:.       ..|..|..|||:||.|..|.:..|.||..
 Frog    70 PYETQSTD-NATNRQIIVDVHNRWRGNVT-------PTAMNMLKMEWNDEAAKKAEIWARTCNQF 126

  Fly   111 HDSCHNTDAFKYS-GQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPA 174
            |:.....:...:| ||||...:||       ...:.:|..||||:.:.:.|  .|  |..: |..
 Frog   127 HNPASQRNITNFSCGQNLFMASYS-------TTWEAAVTAWFDEIKDFDFG--KG--PKTF-GAL 179

  Fly   175 IGHFTVMMSERNTRLGC-------AAARYNRDGWNQVLVACNYATT-NMIGRQ-----IYSSCDW 226
            |||:|......:..:||       |..||        ...|:|... |:.|:|     |..:|..
 Frog   180 IGHYTQGAWYNSRMVGCYEFECPNAEYRY--------YYVCHYCPAGNIEGKQFTPYKIGPTCGD 236

  Fly   227 GAQGCGSGTNGEFGNLCSTSEWYD 250
            ..:.|   .||...|.|.....||
 Frog   237 CPKSC---ENGVCTNYCPHPINYD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 43/156 (28%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 44/163 (27%)
Crisp 234..289 CDD:400739 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.