DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and pi16

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031751055.1 Gene:pi16 / 101731805 XenbaseID:XB-GENE-22068880 Length:548 Species:Xenopus tropicalis


Alignment Length:267 Identity:59/267 - (22%)
Similarity:88/267 - (32%) Gaps:84/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHSHNDK 69
            |:|:::|.|.||                                     :|.:.|.:.:..||..
 Frog    13 LVALVLVELCLA-------------------------------------LNYEEKRIILDKHNFY 40

  Fly    70 RNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQAYSG 134
            |:       ....:|..|..:.||..|..:|.....:|...    ||.|. .:.|:||.  ..||
 Frog    41 RS-------QTEPSASDMIKLTWDSALEAMAKSYAEKCIWE----HNKDR-GFIGENLF--VMSG 91

  Fly   135 DLPDMGYILDNSVQMWFDE--VHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCAAARYN 197
            ...|:...||:    |..|  .:|...|:.       ..|...||:|.|:.....|:||......
 Frog    92 SSLDVALGLDD----WHKERGYYNFTTGMC-------QEGQMCGHYTQMVWAGTERVGCGQNFCP 145

  Fly   198 R----DGWNQVLVACNYATT-NMIGRQIY---SSCDWGAQGCGSGTNGEFGNLC-------STSE 247
            :    |..|..|:.|||... |..|...|   |.|    ..|.| .:...|:||       .:|:
 Frog   146 KLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRC----TECPS-DHVCIGSLCENMNETEKSSQ 205

  Fly   248 WYDVNSW 254
            ...:..|
 Frog   206 VAGITPW 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 38/154 (25%)
pi16XP_031751055.1 CAP_PI16_HrTT-1 30..163 CDD:349405 39/157 (25%)
PHA03247 <200..414 CDD:223021 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.