DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and crisp1.11

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:187 Identity:39/187 - (20%)
Similarity:68/187 - (36%) Gaps:45/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSCPGDAELIDINDDYKWVFVHSHNDKRNYIAGGYDSNHNAACR-MATMEWDDELAYLASLNVRQ 106
            |:.|..:.:...|...:.:.:.:||        .|..|.:.:.| |..|.|:::.|..|:.....
 Frog    44 SADPPFSSISTDNSTVRQIIIDTHN--------AYRRNASPSARNMLKMVWNEDAANNAASWSAG 100

  Fly   107 CNMVHD----------SCHNTDAFKYSGQNLAWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGI 161
            |...|.          ||         |:||...:|...       .:.:|:.||||..:...|:
 Frog   101 CTGSHSPPDKRTIPGFSC---------GENLFLASYPAS-------WEEAVKAWFDENESFEYGV 149

  Fly   162 IAGGYPSGYNGP--AIGHFTVMMSERNTRLGCAAARYNRDGWNQVLVACNYATTNMI 216
                   |...|  .:||:|.:|...:..:||:.:...:..:....| |.|.....|
 Frog   150 -------GPKSPDQVVGHYTQVMWYNSYMVGCSVSYCPKSQYKYFYV-CQYCPAGNI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 34/161 (21%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 35/168 (21%)
Crisp 212..263 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.