DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and pi15

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:280 Identity:70/280 - (25%)
Similarity:101/280 - (36%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILIVSLALAQATDYCSSDICN-------GGSHIACGHSNWW----DSSCPGDAELID-------I 54
            |.:||::.|    :..|.:|.       ..|.:|...||:.    |.|...||..:.       |
 Frog     2 IEMVSISAA----FLLSLLCETCGLVLPKSSDLASAASNYTIIKPDLSARLDAAKVPKARRKRYI 62

  Fly    55 NDDYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDA 119
            :.:.....|..||..|..:       ...|..|..|.||:.||.||......|...|...:   .
 Frog    63 SQNDMIAIVEYHNQVRGKV-------FPPAANMEYMVWDENLAKLAEAWAATCIWDHGPSY---L 117

  Fly   120 FKYSGQNLAWQA--YSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYN--------GPA 174
            .|:.||||:.:.  |...|        ..|:.|:|||.:     .|..||...|        ||.
 Frog   118 LKFLGQNLSVRTGRYKSIL--------QLVKPWYDEVKD-----YAFPYPQECNPRCPLRCYGPM 169

  Fly   175 IGHFTVMMSERNTRLGCAA-ARYNRDGW-----NQVLVACNYATT-NMIGRQIYS---SCDWGAQ 229
            ..|:|.|:.....|:|||. ..:|.:.|     ..|.:.|||:.. |.||...|:   .|     
 Frog   170 CTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPC----- 229

  Fly   230 GCGSGTNGEFGNLCSTSEWY 249
               |.....:|..||.::.:
 Frog   230 ---SACPPSYGGSCSDNQCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 45/164 (27%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 45/167 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.