DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ag5r2 and crispld1a

DIOPT Version :9

Sequence 1:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:204 Identity:54/204 - (26%)
Similarity:74/204 - (36%) Gaps:51/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLA-- 128
            ||..|..:       :..|..|..|.||:||...|......|...|..   .......||||.  
Zfish    74 HNKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETCLWEHGP---AGLLPQIGQNLGVH 128

  Fly   129 WQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYN--------GPAIGHFTVMMSER 185
            |..|.   |...:     ||.|:|||.:     .:..||...|        ||...|:|.::...
Zfish   129 WGRYR---PPTSH-----VQAWYDEVKD-----YSFPYPQECNPHCPFRCSGPVCTHYTQLVWAT 180

  Fly   186 NTRLGCAA-ARYNRDGWNQ-----VLVACNYATT-NMIGRQIY---SSCDWGAQGCGSGTNGEFG 240
            ::|:|||. ..||.:.|.|     |.:.|||:.. |..|...|   :||        |.....:|
Zfish   181 SSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSC--------SACPPSYG 237

  Fly   241 NLCSTSEWY 249
            .:|..:..|
Zfish   238 GVCRENLCY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 44/160 (28%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 44/160 (28%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.