DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and RAN4

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_200319.1 Gene:RAN4 / 835599 AraportID:AT5G55080 Length:222 Species:Arabidopsis thaliana


Alignment Length:204 Identity:122/204 - (59%)
Similarity:153/204 - (75%) Gaps:14/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTA 67
            |:..|:||||.::|||||||||||:|||:|||||.....||||:::||.|.||||.|||..||||
plant     6 QQNVDLPTFKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTA 70

  Fly    68 GQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVK 132
            ||||:.||:|.|||.||||:||||||:|.||.|:..|:|||.|||:||||||||||||:..|::|
plant    71 GQEKYSGLKDAYYIHGQCAIIMFDVTARHTYMNIDRWYRDLRRVCKNIPIVLCGNKVDVPSRQIK 135

  Fly   133 AKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQI 197
            .|.:.:||||.||||::|||:|.|||||||:|||::.||..|.||..|             :|||
plant   136 PKHVSYHRKKCLQYYEMSAKNNCNFEKPFLYLARRIAGDAKLSFVESP-------------EAQI 187

  Fly   198 ER-DLQEAQ 205
            :. |::..|
plant   188 DNLDVESLQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 122/204 (60%)
RAN4NP_200319.1 PLN03071 1..219 CDD:178620 122/204 (60%)
Ran 14..179 CDD:206643 110/164 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.