DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and RAN-1

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_197501.1 Gene:RAN-1 / 832123 AraportID:AT5G20010 Length:221 Species:Arabidopsis thaliana


Alignment Length:214 Identity:158/214 - (73%)
Similarity:180/214 - (84%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTA 67
            |:..|.|:||.|:|||||||||||||||:||||||||..|:|||||||.|.||.|.|||..||||
plant     6 QQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTA 70

  Fly    68 GQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVK 132
            ||||||||||||||.||||:||||||:|:||||||.|||||.||||||||||||||||:|:|:||
plant    71 GQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVK 135

  Fly   133 AKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQI 197
            ||.:.||||||||||:||||||||||||||:|||||.||.||.||..|||.||||.:|...|.:.
plant   136 AKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVETPALAPPEVHIDIADQQKN 200

  Fly   198 ERDLQEAQATALPDEDEEL 216
            |.:|.:|.|..|||:|:::
plant   201 EAELLQAAAQPLPDDDDDI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 158/212 (75%)
RAN-1NP_197501.1 PLN03071 1..218 CDD:178620 158/211 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 283 1.000 Domainoid score I387
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68143
Inparanoid 1 1.050 337 1.000 Inparanoid score I655
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 1 1.000 - - FOG0001651
OrthoInspector 1 1.000 - - otm2632
orthoMCL 1 0.900 - - OOG6_101761
Panther 1 1.100 - - O PTHR24071
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1050
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.