DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and Rasl2-9

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001160147.1 Gene:Rasl2-9 / 751812 RGDID:2314256 Length:216 Species:Rattus norvegicus


Alignment Length:216 Identity:178/216 - (82%)
Similarity:194/216 - (89%) Gaps:0/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWD 65
            ||.:|:....||.|||||||||||||:|||:||||||:||||||||||.|:||||||.|:|||||
  Rat     1 MAGQGKPQIQFKLVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130
            |||||||||||||||||.|||:|||||||||||||||:||:||||||||||||||||||||||.|
  Rat    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDIKDMK 130

  Fly   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQA 195
            ||||.|:||||||||||||||||||||||||.||||||:|||||||||||||.||||.||....|
  Rat   131 VKAKPILFHRKKNLQYYDISAKSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QIERDLQEAQATALPDEDEEL 216
            |.|.||:.||.||||||:::|
  Rat   196 QYEHDLEVAQTTALPDEEDDL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 176/213 (83%)
Rasl2-9NP_001160147.1 RAN 16..215 CDD:128473 170/198 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9201
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1908
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 1 1.000 - - FOG0001651
OrthoInspector 1 1.000 - - otm44564
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1050
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.