DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and ran

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001004829.1 Gene:ran / 448091 XenbaseID:XB-GENE-489468 Length:216 Species:Xenopus tropicalis


Alignment Length:216 Identity:189/216 - (87%)
Similarity:199/216 - (92%) Gaps:0/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWD 65
            ||.:|:....||.|||||||||||||||||:|||||||||||||||||||:||||||.|:|||||
 Frog     1 MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130
            |||||||||||||||||.|||:|||||||||||||||||||||||||||||||||||||||||||
 Frog    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130

  Fly   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQA 195
            ||||||||||||||||||||||||||||||||||||||:||||.||||||||.||||.||....|
 Frog   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNFEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QIERDLQEAQATALPDEDEEL 216
            |.|:|||.||||||||||::|
 Frog   196 QYEQDLQHAQATALPDEDDDL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 187/213 (88%)
ranNP_001004829.1 PTZ00132 1..216 CDD:240284 188/214 (88%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 320 1.000 Domainoid score I1232
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68143
Inparanoid 1 1.050 397 1.000 Inparanoid score I1901
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 1 1.000 - - FOG0001651
OrthoInspector 1 1.000 - - otm47599
Panther 1 1.100 - - LDO PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1050
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.