DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and Rasl2-9

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_033054.1 Gene:Rasl2-9 / 19428 MGIID:104605 Length:216 Species:Mus musculus


Alignment Length:216 Identity:176/216 - (81%)
Similarity:194/216 - (89%) Gaps:0/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWD 65
            ||.:|:....||.|||||||||||||:|||:||||||:||||||||||.|:||||||.|:|||||
Mouse     1 MAAQGEPQVQFKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130
            |||||||||||||||||.|||:|||||||||||||||:||:|||||||||||||||||||:||.|
Mouse    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMK 130

  Fly   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQA 195
            ||||.|:||||||||||||||:|||||||||.||||||:|||||||||||||.||||.||....|
Mouse   131 VKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QIERDLQEAQATALPDEDEEL 216
            |.|.||:.||.||||||:::|
Mouse   196 QYEHDLEVAQTTALPDEEDDL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 174/213 (82%)
Rasl2-9NP_033054.1 Ran 11..176 CDD:206643 145/164 (88%)
RAN 16..215 CDD:128473 168/198 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9389
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1964
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 1 1.000 - - FOG0001651
OrthoInspector 1 1.000 - - otm42500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1050
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.