DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran and Ran

DIOPT Version :9

Sequence 1:NP_001285111.1 Gene:Ran / 44072 FlyBaseID:FBgn0020255 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_033417.1 Gene:Ran / 19384 MGIID:1333112 Length:216 Species:Mus musculus


Alignment Length:216 Identity:188/216 - (87%)
Similarity:198/216 - (91%) Gaps:0/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWD 65
            ||.:|:....||.|||||||||||||||||:|||||||||||||||||||:||||||.|:|||||
Mouse     1 MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130
            |||||||||||||||||.|||:|||||||||||||||||||||||||||||||||||||||||||
Mouse    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRK 130

  Fly   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQA 195
            ||||||||||||||||||||||||||||||||||||||:|||||||||||||.||||.||....|
Mouse   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QIERDLQEAQATALPDEDEEL 216
            |.|.||:.||.|||||||::|
Mouse   196 QYEHDLEVAQTTALPDEDDDL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RanNP_001285111.1 PTZ00132 2..216 CDD:240284 186/213 (87%)
RanNP_033417.1 RAN 16..215 CDD:128473 180/198 (91%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 320 1.000 Domainoid score I1238
eggNOG 1 0.900 - - E1_KOG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68143
Inparanoid 1 1.050 393 1.000 Inparanoid score I1964
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53961
OrthoDB 1 1.010 - - D1083175at2759
OrthoFinder 1 1.000 - - FOG0001651
OrthoInspector 1 1.000 - - otm42500
orthoMCL 1 0.900 - - OOG6_101761
Panther 1 1.100 - - LDO PTHR24071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1381
SonicParanoid 1 1.000 - - X1050
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.