DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcr and AI182371

DIOPT Version :9

Sequence 1:NP_524688.1 Gene:Mcr / 44071 FlyBaseID:FBgn0267488 Length:1760 Species:Drosophila melanogaster
Sequence 2:XP_017174840.1 Gene:AI182371 / 98870 MGIID:2138853 Length:366 Species:Mus musculus


Alignment Length:244 Identity:52/244 - (21%)
Similarity:106/244 - (43%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FLESLHSREPTYFIVASRMV-RPGLIYQVSV-----------SILQAQYPITVHASIACDGVQIS 173
            |||....:|.|.:|:::.:| |.|....|:|           ::....|| ..:...:...|.:|
Mouse    30 FLEQSWGQEQTRYIISTPIVFRVGAPENVTVQAHGHTEAFDTTVSVKSYP-DENVRYSFSTVNLS 93

  Fly   174 GDSKDVKEGIPETLLMRIPPTSVTGSYKLRVEGFYQNVFGGLAFLNETRLDFSQRSM-------- 230
            .::|     ...|.::.|....::       ||  ||.|.. ::|......|::..:        
Mouse    94 PENK-----FQNTAILTIQAKQLS-------EG--QNSFSN-SYLEVVSKHFAKLEIVPIIYDND 143

  Fly   231 TIFVQTDKPLYMQGETVRFRTIPITTELKGFDNPVDVYMLDPNRHILKRWLSRQSNLGSVSL--E 293
            ::||||||.:|...:.|:.|...:..:|:.......:..:||....:.  ....:||..::.  :
Mouse   144 SLFVQTDKSVYTPQQPVKVRVYSVNDDLEPATRETVLTFIDPEGSQVD--TIEGNNLTGIASFPD 206

  Fly   294 YKLSDQPTFGEWTIRVIAQGQQEES-----HFTVEEYYQTRFEVNVTMP 337
            :::...|..|.||::  |:.:::.|     :|.|:||.:| :.::: ||
Mouse   207 FEIPSNPKHGRWTVK--AKYREDASKTGTTYFEVKEYDKT-YRISI-MP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McrNP_524688.1 A2M_N 232..332 CDD:280081 25/106 (24%)
A2M_N_2 669..799 CDD:285005
LDLa 886..913 CDD:238060
A2M 940..1030 CDD:278630
ISOPREN_C2_like 1177..1490 CDD:298658
A2M_comp 1226..1492 CDD:284982
A2M_recep 1607..1695 CDD:284981
AI182371XP_017174840.1 MG1 42..138 CDD:375333 20/111 (18%)
A2M_N 145..238 CDD:376626 21/96 (22%)
ANATO 279..347 CDD:237984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.