DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcr and LOC101731171

DIOPT Version :9

Sequence 1:NP_524688.1 Gene:Mcr / 44071 FlyBaseID:FBgn0267488 Length:1760 Species:Drosophila melanogaster
Sequence 2:XP_012809794.2 Gene:LOC101731171 / 101731171 -ID:- Length:165 Species:Xenopus tropicalis


Alignment Length:69 Identity:24/69 - (34%)
Similarity:36/69 - (52%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1429 RLPY-EYDSLNIETTAYALLVYVARREFFVD------PIVRWLNSQRLNDGGWASTQDTSAALKA 1486
            |.|| ...|..:|..:|.||..:::.....|      .:|.|:..|:..:||::|||||..||:|
 Frog    47 RFPYRRAPSAEVEMNSYMLLALLSKPNVSDDDLTLATQVVSWMIKQQNPNGGFSSTQDTVVALQA 111

  Fly  1487 LVEY 1490
            |..|
 Frog   112 LSLY 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McrNP_524688.1 A2M_N 232..332 CDD:280081
A2M_N_2 669..799 CDD:285005
LDLa 886..913 CDD:238060
A2M 940..1030 CDD:278630
ISOPREN_C2_like 1177..1490 CDD:298658 23/67 (34%)
A2M_comp 1226..1492 CDD:284982 24/69 (35%)
A2M_recep 1607..1695 CDD:284981
LOC101731171XP_012809794.2 ISOPREN_C2_like <1..115 CDD:415487 23/67 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D354230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.