powered by:
Protein Alignment Mcr and LOC101731171
DIOPT Version :9
Sequence 1: | NP_524688.1 |
Gene: | Mcr / 44071 |
FlyBaseID: | FBgn0267488 |
Length: | 1760 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012809794.2 |
Gene: | LOC101731171 / 101731171 |
-ID: | - |
Length: | 165 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 24/69 - (34%) |
Similarity: | 36/69 - (52%) |
Gaps: | 7/69 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1429 RLPY-EYDSLNIETTAYALLVYVARREFFVD------PIVRWLNSQRLNDGGWASTQDTSAALKA 1486
|.|| ...|..:|..:|.||..:::.....| .:|.|:..|:..:||::|||||..||:|
Frog 47 RFPYRRAPSAEVEMNSYMLLALLSKPNVSDDDLTLATQVVSWMIKQQNPNGGFSSTQDTVVALQA 111
Fly 1487 LVEY 1490
|..|
Frog 112 LSLY 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D354230at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.