DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and RPL30

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_011485.1 Gene:RPL30 / 852853 SGDID:S000002998 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:68/108 - (62%)
Similarity:85/108 - (78%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |..||.|    ||.|.:||||:|||||.||||.|:|:|||||:||::||:|||.|||||:|||||
Yeast     1 MAPVKSQ----ESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAM 61

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            |:||:|.::.|.|.|||||.||.|||..:||.:.|||||:.:|
Yeast    62 LSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 67/107 (63%)
RPL30NP_011485.1 PTZ00106 5..104 CDD:185450 65/102 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345794
Domainoid 1 1.000 127 1.000 Domainoid score I1176
eggNOG 1 0.900 - - E1_COG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H766
Inparanoid 1 1.050 133 1.000 Inparanoid score I1231
Isobase 1 0.950 - 0 Normalized mean entropy S181
OMA 1 1.010 - - QHG62191
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - oto99699
orthoMCL 1 0.900 - - OOG6_100932
Panther 1 1.100 - - LDO PTHR11449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1127
SonicParanoid 1 1.000 - - X1111
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.