DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and AT1G36240

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_174853.1 Gene:AT1G36240 / 840530 AraportID:AT1G36240 Length:112 Species:Arabidopsis thaliana


Alignment Length:108 Identity:77/108 - (71%)
Similarity:87/108 - (80%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |||.||.||:.|..|:|||||||||||.||||..||:||..|.||:||:||.|.||:||||||||
plant     1 MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAM 65

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            |||..|.||:..|::|||||||||||..|||.||||||||:||
plant    66 LAKVGVHHYNRNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 76/107 (71%)
AT1G36240NP_174853.1 PTZ00106 2..108 CDD:185450 74/105 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1547
eggNOG 1 0.900 - - E1_COG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H766
Inparanoid 1 1.050 155 1.000 Inparanoid score I1676
OMA 1 1.010 - - QHG62191
OrthoDB 1 1.010 - - D1503991at2759
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - otm3530
orthoMCL 1 0.900 - - OOG6_100932
Panther 1 1.100 - - O PTHR11449
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1111
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.