DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and Gm6109

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_889797.1 Gene:Gm6109 / 619883 MGIID:3643032 Length:115 Species:Mus musculus


Alignment Length:108 Identity:81/108 - (75%)
Similarity:93/108 - (86%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |||.||.||:|||.|:||.|||.||||.|.||||||.:||||||||::|::.|.|||||||:|||
Mouse     1 MVAAKKTKKSLESINSRLQLVMNSGKYVLSYKQTLKMVRQGKAKLVILANSCPDLRKSEIEFYAM 65

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            ||||.|.:|.|.|||||||||||:|||||:|.||||||||||:
Mouse    66 LAKTGVHYYRGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSM 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 80/107 (75%)
Gm6109XP_889797.1 PTZ00106 2..107 CDD:185450 78/104 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503991at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.