DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and rpl30

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001005110.1 Gene:rpl30 / 448690 XenbaseID:XB-GENE-6455569 Length:116 Species:Xenopus tropicalis


Alignment Length:108 Identity:88/108 - (81%)
Similarity:97/108 - (89%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |||.||.||:|||.|:||.||||||||.||||||||.:||||||||::|:|.|||||||||||||
 Frog     1 MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAM 65

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            ||||.|.||||.|||||||||||:|||||:|.||||||||||:
 Frog    66 LAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSM 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 87/107 (81%)
rpl30NP_001005110.1 PTZ00106 2..107 CDD:185450 85/104 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4081
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H766
Inparanoid 1 1.050 179 1.000 Inparanoid score I3904
OMA 1 1.010 - - QHG62191
OrthoDB 1 1.010 - - D1503991at2759
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - oto103977
Panther 1 1.100 - - LDO PTHR11449
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.