DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and Rpl30-ps7

DIOPT Version :10

Sequence 1:NP_524687.1 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_063129889.1 Gene:Rpl30-ps7 / 364129 RGDID:1562394 Length:113 Species:Rattus norvegicus


Alignment Length:108 Identity:78/108 - (72%)
Similarity:86/108 - (79%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |||.||.||:||..|.||.||||:|||..|.|||||.:||||||||:: .|.|||||||||||:|
  Rat     1 MVAAKKMKKSLELINFRLQLVMKTGKYMKGNKQTLKMIRQGKAKLVIL-DNCPALRKSEIEYYSM 64

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            ||||...||||.||.||||||||.:||||.|.|||||| |||:
  Rat    65 LAKTSDHHYSGNNIALGTACGKYCKVCTLVIIDPGDSD-IRSM 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_524687.1 PTZ00106 2..109 CDD:185450 77/107 (72%)
Rpl30-ps7XP_063129889.1 None

Return to query results.
Submit another query.