DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and rpl3002

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_594857.1 Gene:rpl3002 / 2542661 PomBaseID:SPAC1250.05 Length:117 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:69/101 - (68%)
Similarity:83/101 - (82%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAMLAKT 69
            ||.||:.::.|::|||.||||||.||||.||||||.|||||:|||:|.|.|||||:||||||::.
pombe    15 KKGKKSGDTINSKLALTMKSGKYVLGYKSTLKTLRSGKAKLILIAANAPPLRKSELEYYAMLSRC 79

  Fly    70 EVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDII 105
            .|.||||.||:|||||||.|||..|::.|.|||||:
pombe    80 SVHHYSGNNIDLGTACGKLFRVGVLAVIDAGDSDIL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 69/101 (68%)
rpl3002NP_594857.1 PTZ00106 14..117 CDD:185450 69/101 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1167
eggNOG 1 0.900 - - E1_COG1911
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H766
Inparanoid 1 1.050 151 1.000 Inparanoid score I1301
OMA 1 1.010 - - QHG62191
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - otm47275
orthoMCL 1 0.900 - - OOG6_100932
Panther 1 1.100 - - LDO PTHR11449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1127
SonicParanoid 1 1.000 - - X1111
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.