DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and rpl-30

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_492728.2 Gene:rpl-30 / 172921 WormBaseID:WBGene00004444 Length:115 Species:Caenorhabditis elegans


Alignment Length:107 Identity:77/107 - (71%)
Similarity:91/107 - (85%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVKKQ-KKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAML 66
            |.|.| ||..|:.|:||::|||:|:|.||||||||:|..||||||:||:|||.||||||||||||
 Worm     4 AAKPQVKKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEIEYYAML 68

  Fly    67 AKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            |||.|.||:|.|||||||||:.||||||::||.||||||.|:
 Worm    69 AKTGVHHYNGNNIELGTACGRLFRVCTLAVTDAGDSDIILSV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 77/107 (72%)
rpl-30NP_492728.2 PTZ00106 4..110 CDD:185450 76/105 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165749
Domainoid 1 1.000 148 1.000 Domainoid score I2753
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H766
Inparanoid 1 1.050 154 1.000 Inparanoid score I2927
Isobase 1 0.950 - 0 Normalized mean entropy S181
OMA 1 1.010 - - QHG62191
OrthoDB 1 1.010 - - D1503991at2759
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - oto17985
orthoMCL 1 0.900 - - OOG6_100932
Panther 1 1.100 - - LDO PTHR11449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1127
SonicParanoid 1 1.000 - - X1111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.