DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL30 and LOC108351936

DIOPT Version :9

Sequence 1:NP_001260550.2 Gene:RpL30 / 44059 FlyBaseID:FBgn0086710 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_017452298.1 Gene:LOC108351936 / 108351936 RGDID:11470202 Length:115 Species:Rattus norvegicus


Alignment Length:108 Identity:85/108 - (78%)
Similarity:95/108 - (87%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAM 65
            |||.||.||:|||.|:||.|||||.|..||||||||.:||||||||::|:|.||||||||||.||
  Rat     1 MVAAKKMKKSLESINSRLQLVMKSRKSMLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYSAM 65

  Fly    66 LAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPGDSDIIRSL 108
            ||||.|:||||.|||||||||||:|||||:|.||||||||||:
  Rat    66 LAKTGVRHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSM 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL30NP_001260550.2 PTZ00106 2..109 CDD:185450 84/107 (79%)
LOC108351936XP_017452298.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351814
Domainoid 1 1.000 158 1.000 Domainoid score I4009
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3909
OMA 1 1.010 - - QHG62191
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001538
OrthoInspector 1 1.000 - - otm45561
orthoMCL 1 0.900 - - OOG6_100932
Panther 1 1.100 - - O PTHR11449
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.