DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT71C3

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_172206.1 Gene:UGT71C3 / 837237 AraportID:AT1G07260 Length:476 Species:Arabidopsis thaliana


Alignment Length:460 Identity:110/460 - (23%)
Similarity:171/460 - (37%) Gaps:121/460 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILAVYPHFGFSHFKVVMPILNELAHRG---HDITVISYV--KNPQAG----------------AY 72
            |...||..|  |..|.:.....|..|.   |.||::.:.  ..|||.                |.
plant     8 IFVTYPSPG--HLLVSIEFAKSLIKRDDRIHTITILYWALPLAPQAHLFAKSLVASQPRIRLLAL 70

  Fly    73 PNYE-----ELLISAPGEDQSSTTINLVPLTEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGH 132
            |:.:     ||...||......:|...||            |:|:.:......:|      .||.
plant    71 PDVQNPPPLELFFKAPEAYILESTKKTVP------------LVRDALSTLVSSRK------ESGS 117

  Fly   133 IERAIERHRNKPYDLLLTEYFNSDC--QLALAKLLNLPIIGLSTC-----ALMPYYYDRIDLPDT 190
            : |.:.         |:.::|   |  .:.:|..||||.....||     ::|.|      ||:.
plant   118 V-RVVG---------LVIDFF---CVPMIEVANELNLPSYIFLTCNAGFLSMMKY------LPER 163

  Fly   191 PAFIQSEFVGFAGQLNWHERLLNFVQAKLLKF----LYKYHSNRADNELVRKYLGVE-VDVEEV- 249
            .....||....:|  |....:..:|.:...|.    |:...|..|..|:..|:.|.: :.|..| 
plant   164 HRITTSELDLSSG--NVEHPIPGYVCSVPTKVLPPGLFVRESYEAWVEIAEKFPGAKGILVNSVT 226

  Fly   250 ARTQTAFIFG---NQHYSLMGSRPQSLQFVEIGGVHITKKAEQELP-------QNIANFL-NQSA 303
            ...|.||.:.   :::|.         ....:|.|...|  ::..|       ..|..:| :|..
plant   227 CLEQNAFDYFARLDENYP---------PVYPVGPVLSLK--DRPSPNLDASDRDRIMRWLEDQPE 280

  Fly   304 EGVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIWKWEADETP-------------DTDASK 355
            ..:::|.:||:   ..|.:.::..|.|.|:....:.:|....:.|.             |..|||
plant   281 SSIVYICFGSL---GIIGKLQIEEIAEALELTGHRFLWSIRTNPTEKASPYDLLPEGFLDRTASK 342

  Fly   356 FLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAFS-VQNRGMG-- 417
            .|...||||:.:|.|..:..|.||.|.....||:..|.|:...|:|.:|.||||| |:..|:.  
plant   343 GLVCDWAPQVEVLAHKALGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQLNAFSMVKELGLAVE 407

  Fly   418 LKLDY 422
            |:|||
plant   408 LRLDY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 110/460 (24%)
UDPGT 38..501 CDD:278624 106/451 (24%)
UGT71C3NP_172206.1 PLN02167 2..476 CDD:215112 110/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.