DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT75B1

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001320882.1 Gene:UGT75B1 / 837058 AraportID:AT1G05560 Length:519 Species:Arabidopsis thaliana


Alignment Length:407 Identity:88/407 - (21%)
Similarity:148/407 - (36%) Gaps:127/407 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 VDLHEEGQKTCE------HLF-----ASGHI-------ERAIERHRNKPYDLLLTEYFNSDCQLA 160
            :|.|..|.||..      |..     |.||:       .|.|:|...:...:.....|::.....
plant    37 IDTHFSGAKTSRKKMAPPHFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIAN 101

  Fly   161 LAKLLNLPII---------GLSTCALMPYYYDR----IDLPDTPAFIQSEFVG------------ 200
            ..|:.||..:         |:||      |.||    ::|........|:|:.            
plant   102 HNKVENLSFLTFSDGFDDGGIST------YEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCL 160

  Fly   201 -FAGQLNWHERL---------LNFVQAKLLKFLYKYH--SNRADNEL-------VR--------- 237
             :...|||..::         |.::|..|:..:|..|  .|::..||       :|         
plant   161 IYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPS 225

  Fly   238 -----KYLGVEVDVEEVARTQTAFIFGNQHYSLMGSRPQSL-QFVEIGGVHI------------T 284
                 .|...:..:|.:.:.....|..|...||   .|::| .|..|..|.:            |
plant   226 NTNKGAYDAFQEMMEFLIKETKPKILINTFDSL---EPEALTAFPNIDMVAVGPLLPTEIFSGST 287

  Fly   285 KKAEQELPQNIANFLNQSAE-GVIFISWGSMVRASSIDEDKLS-AILEVLKSQPLKIIW------ 341
            .|:.::...:...:|:...| .||::|:|:||..|....::|: |::|  ..:|  .:|      
plant   288 NKSVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIE--GKRP--FLWVITDKS 348

  Fly   342 ----KWEADETPDTDASKF-----------LFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHC 391
                |.|.:|  :|:..|.           :.|.|..|:.:|.|..|..|.:|.|...|.||:..
plant   349 NRETKTEGEE--ETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVL 411

  Fly   392 GKPLLVTPIYGDQFLNA 408
            |.|::..|::.||..||
plant   412 GVPVVAFPMWSDQPTNA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 88/407 (22%)
UDPGT 38..501 CDD:278624 88/407 (22%)
UGT75B1NP_001320882.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.